Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KCNK17 (Potassium two pore domain channel subfamily K member 17) Full Length (CAT#: MPC0622K) Made to Order

This product is a 36.8 kDa Human KCNK17 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KCNK17
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 36.8 kDa
  • TMD
  • 4
  • Sequence
  • MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQD
    SSRSFQRDKWELLQNFTCLDRPALDSLIRDVVQAYKNGASLLSNTTSMGR
    WELVGSFFFSVSTITTIGYGNLSPNTMAARLFCIFFALVGIPLNLVVLNR
    LGHLMQQGVNHWASRLGGTWQDPDKARWLAGSGALLSGLLLFLLLPPLLF
    SHMEGWSYTEGFYFAFITLSTVGFGDYVIGMNPSQRYPLWYKNMVSLWIL
    FGMAWLALIIKLILSQLETPGRVCSCCHHSSKEDFKSQSWRQGPDREPES
    HSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • KCNK17
  • Full Name
  • Potassium two pore domain channel subfamily K member 17
  • Introduction
  • The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. This gene is activated at alkaline pH. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • TALK2; TASK4; TALK-2; TASK-4; K2p17.1; potassium channel subfamily K member 17; 2P domain potassium channel Talk-2; TWIK-related acid-sensitive K(+) channel 4; TWIK-related acid-sensitive K+ 4; TWIK-related alkaline pH-activated K(+) channel 2; acid-sensitive potassium channel protein TASK-4; potassium channel, two pore domain subfamily K, member 17; KCNK17; Potassium two pore domain channel subfamily K member 17

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us