Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KLRA1P (Killer cell lectin like receptor A1, pseudogene) for Antibody Discovery (CAT#: MP0371J)

This product is a 25.3 kDa Human KLRA1P membrane protein expressed in HEK293T. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KLRA1P
  • Protein Length
  • Full-length
  • Protein Class
  • Transmembrane
  • Molecular Weight
  • 25.3 kDa
  • Sequence
  • MNDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTLGILCLLLLMIVTVLVTNIF
    QCIQEKHQRQEILRNCSEKYIMQNDNYLKEQILTNKTLKYDVLKNSFQQKKELDSRLIQKNRCHRENEIV
    FKVLQNTGKFSEDHGSCCGVNCYYFTMQKKDWKGCKQTCQHCRSSLLKIDDKDELVFYIHFYSLGLCFSM
    LDLRY

Product Description

  • Expression Systems
  • HEK293T
  • Tag
  • C-Myc/DDK
  • Purification
  • Anti-DDK affinity column followed by conventional chromatography steps
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Target

  • Target Protein
  • KLRA1P
  • Full Name
  • Killer cell lectin like receptor A1, pseudogene
  • Introduction
  • This locus was originally considered to be protein coding, but has been reclassified as a transcribed pseudogene because all associated transcripts are candidates for nonsense-mediated decay (NMD).
  • Alternative Names
  • A1; class I MHC receptor KLRA22; killer cell lectin-like receptor, subfamily A, member 1; KLRA#; Klra22; Ly-49L; Ly49; Ly49a; LY49L; Ly49o; Ly49v; MGC126520; MGC126522; natural killer cell receptor Ly49A; OTTMUSP00000026268

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us