Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human KLRB1 (Killer cell lectin like receptor B1) Full Length (CAT#: MPC2263K) Made to Order

This product is a 25.4 kDa Human KLRB1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • KLRB1
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 25.4 kDa
  • TMD
  • 1
  • Sequence
  • MDQQAIYAELNLPTDSGPESSSPSSLPRDVCQGSPWHQFALKLSCAGIIL
    LVLVVTGLSVSVTSLIQKSSIEKCSVDIQQSRNKTTERPGLLNCPIYWQQ
    LREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIHTQNLIRDKAI
    LFWIGLNFSLSEKNWKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSE
    YCSTEIRWICQKELTPVRNKVYPDS

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • KLRB1
  • Full Name
  • Killer cell lectin like receptor B1
  • Introduction
  • Natural killer (NK) cells are lymphocytes that mediate cytotoxicity and secrete cytokines after immune stimulation. Several genes of the C-type lectin superfamily, including the rodent NKRP1 family of glycoproteins, are expressed by NK cells and may be involved in the regulation of NK cell function. The KLRB1 protein contains an extracellular domain with several motifs characteristic of C-type lectins, a transmembrane domain, and a cytoplasmic domain. The KLRB1 protein is classified as a type II membrane protein because it has an external C terminus.
  • Alternative Names
  • KLRB1; NKR; CD161; CLEC5B; NKR-P1; NKRP1A; NKR-P1A; hNKR-P1A; killer cell lectin-like receptor subfamily B member 1; C-type lectin domain family 5 member B; killer cell lectin-like receptor subfamily B, member 1; natural killer cell surface protein P1A; Killer cell lectin like receptor B1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us