Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human UQCRQ (Ubiquinol-cytochrome c reductase complex III subunit VII) Full Length (CAT#: MPC2164K) Made to Order

This product is a 9.9 kDa Human UQCRQ membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • UQCRQ
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 9.9 kDa
  • TMD
  • 1
  • Sequence
  • MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVV
    PQFVVFYLIYTWGTEEFERSKRKNPAAYENDK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • UQCRQ
  • Full Name
  • Ubiquinol-cytochrome c reductase complex III subunit VII
  • Introduction
  • This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain.
  • Alternative Names
  • UQCRQ; QPC; QCR8; QP-C; UQCR7; MC3DN4; cytochrome b-c1 complex subunit 8; complex III subunit 8; complex III subunit VIII; low molecular mass ubiquinone-binding protein (9.5kD); ubiquinol-cytochrome c reductase complex 9.5 kDa protein; ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C; ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa; Ubiquinol-cytochrome c reductase complex III subunit VII

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us