Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human LAPTM5 (Lysosomal protein transmembrane 5) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2326K)

This product is a Human LAPTM5 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LAPTM5
  • Protein Length
  • Full Length
  • Protein Class
  • Transport
  • TMD
  • 5
  • Sequence
  • MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRIADLISSFLLITMLFIISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAYLKLASRSRASSSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMPHNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEV

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • LAPTM5
  • Full Name
  • Lysosomal protein transmembrane 5
  • Introduction
  • This gene encodes a transmembrane receptor that is associated with lysosomes. The encoded protein, also known as E3 protein, may play a role in hematopoiesis.
  • Alternative Names
  • LAPTM5; CLAST6; CD40-ligand-activated specific transcripts; human retinoic acid-inducible E3 protein; lysosomal associated multispanning membrane protein 5; lysosomal multispanning membrane protein 5; lysosomal-associated multitransmembrane protein 5; retinoic acid-inducible E3 protein; Lysosomal protein transmembrane 5

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us