Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human LAT2 (Linker for activation of T cells family member 2) Full Length (CAT#: MPC2646K) Made to Order

This product is a made-to-order Human LAT2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LAT2
  • Protein Length
  • Full length
  • Protein Class
  • Immunity
  • TMD
  • 1
  • Sequence
  • MSSGTELLWPGAALLVLLGVAASLCVRCSRPGAKRSEKIYQQRSLREDQQ
    SFTGSRTYSLVGQAWPGPLADMAPTRKDKLLQFYPSLEDPASSRYQNFSK
    GSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVLICKQKTTETG
    AQQEGIGGLCRGDLSLSLALKTGPTSGLCPSASPEEDEESEDYQNSASIH
    QWRESRKVMGQLQREASPGPVGSPDEEDGEPDYVNGEVAATEA

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • LAT2
  • Full Name
  • Linker for activation of T cells family member 2
  • Introduction
  • This gene is one of the contiguous genes at 7q11.23 commonly deleted in Williams syndrome, a multisystem developmental disorder. This gene consists of at least 14 exons, and its alternative splicing generates 3 transcript variants, all encoding the same protein.
  • Alternative Names
  • LAT2; LAB; NTAL; WSCR5; WBSCR5; HSPC046; WBSCR15; Williams-Beuren syndrome chromosomal region 15 protein; Williams-Beuren syndrome chromosomal region 5 protein; linker for activation of B-cells; linker for activation of T cells, transmembrane adaptor 2; membrane-associated adapter molecule; non-T-cell activation linker; Linker for activation of T cells family member 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us