Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MARCH8 (Membrane associated ring-CH-type finger 8) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1576K)

This product is a Human MARCH8 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MARCH8
  • Protein Length
  • Full Length
  • Protein Class
  • Transferase
  • TMD
  • 2
  • Sequence
  • MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRTSITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLRKWEKLQMTSSERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGILEWPFWTKLVVVAIGFTGGLLFMYVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGYGICHSDTNSSCCTEPEDTGAEIIHV

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • MARCH8
  • Full Name
  • Membrane associated ring-CH-type finger 8
  • Introduction
  • MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH8 induces the internalization of several membrane glycoproteins.
  • Alternative Names
  • MARCH8; MIR; CMIR; c-MIR; MARCH8; RNF178; MARCH-VIII; E3 ubiquitin-protein ligase MARCHF8; E3 ubiquitin-protein ligase MARCH8; RING finger protein 178; RING-type E3 ubiquitin transferase MARCH8; RING-type E3 ubiquitin transferase MARCHF8; c-mir, cellular modulator of immune recognition; cellular modulator of immune recognition (c-MIR); membrane associated ring finger 8; membrane-associated RING finger protein 8; membrane-associated RING-CH protein VIII; membrane-associated ring finger (C3HC4) 8, E3 ubiquitin protein ligase; Membrane associated ring-CH-type finger 8

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us