Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MRAP (Melanocortin 2 receptor accessory protein) Full Length (CAT#: MPC3991K) Made to Order

This product is a made-to-order Human MRAP membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MRAP
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFV
    VLLFLILLYMSWSASPQMRNSPKHHQTCPWSHGLNLHLCIQKCLPCHREP
    LATSQAQASSVEPGSRTGPDQPLRQESSSTLPLGGFQTHPTLLWELTLNG
    GPLVRSKPSEPPPGDRTSQLQS

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • MRAP
  • Full Name
  • Melanocortin 2 receptor accessory protein
  • Introduction
  • This gene encodes a melanocortin receptor-interacting protein. The encoded protein regulates trafficking and function of the melanocortin 2 receptor in the adrenal gland. The encoded protein can also modulate signaling of other melanocortin receptors. Mutations in this gene have been associated with familial glucocorticoid deficiency type 2. Alternatively spliced transcript variants have been described.
  • Alternative Names
  • MRAP; B27; FALP; FGD2; GCCD2; C21orf61; melanocortin-2 receptor accessory protein; fat cell-specific low molecular weight protein; fat tissue-specific low MW protein; Melanocortin 2 receptor accessory protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us