Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MUSTN1 (Musculoskeletal, embryonic nuclear protein 1) expressed in Sf9 for Antibody Discovery (CAT#: MP0084Q)

This product is a 8.7 kDa Human MUSTN1 membrane protein expressed in Sf9. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MUSTN1
  • Protein Length
  • Full-length
  • Protein Class
  • Transmembrane
  • Molecular Weight
  • 8.7 kDa
  • Sequence
  • MSQAGAQEAPIKKKRPPVKEEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFEKPKAGPTKSVFG

Product Description

  • Expression Systems
  • Sf9
  • Tag
  • C-DDK
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 50mM Tris-HCl, pH8.0, 100mM glycine, 10% glycerol

Target

  • Target Protein
  • MUSTN1
  • Full Name
  • Musculoskeletal, embryonic nuclear protein 1
  • Introduction
  • The MUSTN1 gene is conserved in chimpanzee, dog, cow, mouse, rat, chicken, and frog.
  • Alternative Names
  • musculoskeletal embryonic nuclear protein 1; musculoskeletal temporally activated novel

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us