Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MUSTN1 (Musculoskeletal, embryonic nuclear protein 1) expressed in E. coli for Antibody Discovery (CAT#: MP0169Q)

This product is a 11.3 kDa Human MUSTN1 membrane protein expressed in E. coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MUSTN1
  • Protein Length
  • Partial
  • Protein Class
  • Transmembrane
  • Molecular Weight
  • 11.3 kDa
  • Sequence
  • MGSSHHHHHHSSGLVPRGSHMGSMSQAGAQEAPIKKKRPPVKEEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFEKPKAGPTKSVFG

Product Description

  • Expression Systems
  • E. coli
  • Tag
  • His
  • Purity
  • >80% by SDS - PAGE
  • Buffer
  • 20 mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol, 1mM DTT

Target

  • Target Protein
  • MUSTN1
  • Full Name
  • Musculoskeletal, embryonic nuclear protein 1
  • Introduction
  • May be involved in the development and regeneration of the musculoskeletal system.
  • Alternative Names
  • MUSTANG; musculoskeletal embryonic nuclear protein 1; musculoskeletal temporally activated novel

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us