Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NAT8 (N-acetyltransferase 8 (putative)) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1425K)

This product is a Human NAT8 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NAT8
  • Protein Length
  • Full Length
  • Protein Class
  • Transferase
  • TMD
  • 1
  • Sequence
  • MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSWLLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLPSSKVGSL

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • NAT8
  • Full Name
  • N-acetyltransferase 8 (putative)
  • Introduction
  • This gene, isolated using the differential display method to detect tissue-specific genes, is specifically expressed in kidney and liver. The encoded protein shows amino acid sequence similarity to N-acetyltransferases. A similar protein in Xenopus affects cell adhesion and gastrulation movements, and may be localized in the secretory pathway. A highly similar paralog is found in a cluster with this gene.
  • Alternative Names
  • NAT8; GLA; CML1; CCNAT; Hcml1; ATase2; TSC501; TSC510; N-acetyltransferase 8; acetyltransferase 2; camello-like protein 1; cysteinyl-conjugate N-acetyltransferase; kidney- and liver-specific gene product; probable N-acetyltransferase 8; N-acetyltransferase 8 (putative)

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us