Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NAT8B (N-acetyltransferase 8B (putative, gene/pseudogene)) Full Length (CAT#: MPC4826K) Made to Order

This product is a made-to-order Human NAT8B membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NAT8B
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • TMD
  • 1
  • Sequence
  • MAPYHIRKYQESDRKSVVGLLSGGMAEHAPATFRRLLKLPRTLILLLGGA
    LALLLVSGSWILALVFSLSLLPALWFLAKKPWTRYVDIALRTDMSDITKS
    YLSECGSCFWVAESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRG
    QGIAKALVRTVLQFARDQGYSEVVLDTSNIQLSAMGLYQSLGFKKTGQSF
    FHVWARLVDLHTVHFIYHLPSAQAGRL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • NAT8B
  • Full Name
  • N-acetyltransferase 8B (putative, gene/pseudogene)
  • Introduction
  • The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance. This gene is localized on chromosome 2 in the vicinity of the NAT8 gene and may represent a pseudogene of NAT8. This gene contains two polymorphic nonsense mutations that disrupt the active site of the protein. The full-length product of this gene contains a complete acetyltransferase domain and is identical in length to NAT8.
  • Alternative Names
  • NAT8B; CML2; Hcml2; NAT8BP; putative N-acetyltransferase 8B; ATase1; N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene); N-acetyltransferase Camello 2; acetyltransferase 1; camello-like protein 2; probable N-acetyltransferase 8B; N-acetyltransferase 8B (putative, gene/pseudogene)

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us