Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NDUFA3 (NADH:ubiquinone oxidoreductase subunit A3) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1033K)

This product is a Human NDUFA3 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NDUFA3
  • Protein Length
  • Full Length
  • Protein Class
  • Transport
  • TMD
  • 1
  • Sequence
  • MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis and SUMO tag
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • NDUFA3
  • Full Name
  • NADH:ubiquinone oxidoreductase subunit A3
  • Alternative Names
  • NDUFA3; B9; CI-B9; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa; NADH-ubiquinone oxidoreductase B9 subunit; complex I B9 subunit; complex I-B9; NADH:ubiquinone oxidoreductase subunit A3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us