Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human OPRK1 (Opioid receptor kappa 1) Full Length (CAT#: MPC0317K) Made to Order

This product is a 42.6 kDa Human OPRK1 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • OPRK1
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 42.6 kDa
  • TMD
  • 7
  • Sequence
  • MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLE
    PAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFN
    LALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLT
    MMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTK
    VREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVLIIIVCYTLMI
    LRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
    STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKM
    RMERQSTSRVRNTVQDPAYLRDIDGMNKPV

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Flag and 10xHis tag at N-terminal
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • OPRK1
  • Full Name
  • Opioid receptor kappa 1
  • Introduction
  • This gene encodes an opioid receptor, which is a member of the 7 transmembrane-spanning G protein-coupled receptor family. It functions as a receptor for endogenous ligands, as well as a receptor for various synthetic opioids. Ligand binding results in inhibition of adenylate cyclase activity and neurotransmitter release. This opioid receptor plays a role in the perception of pain and mediating the hypolocomotor, analgesic and aversive actions of synthetic opioids. Variations in this gene have also been associated with alcohol dependence and opiate addiction. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study provided evidence for translational readthrough in this gene, and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon.
  • Alternative Names
  • KOP; KOR; KOR1; OPRK; KOR-1; K-OR-1; kappa-type opioid receptor; Opiate receptor, kappa-1; kappa opioid receptor; OPRK1; Opioid receptor kappa 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us