Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PDPN (Podoplanin) Full Length (CAT#: MPC1014K) Made to Order

This product is a 16.6 kDa Human PDPN membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PDPN
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 16.6 kDa
  • TMD
  • 1
  • Sequence
  • MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDV
    VTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSAT
    ASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIV
    VVMRKMSGRYSP

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • PDPN
  • Full Name
  • Podoplanin
  • Introduction
  • This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury. Alternatively spliced transcript variants encoding different isoforms have been identified.
  • Alternative Names
  • PDPN; T1A; GP36; GP40; Gp38; OTS8; T1A2; TI1A; T1A-2; AGGRUS; HT1A-1; PA2.26; PA2.26 antigen; T1-alpha; glycoprotein 36; glycoprotein, 36-KD; hT1alpha-1; hT1alpha-2; lung type I cell membrane associated glycoprotein; lung type-I cell membrane-associated glycoprotein (T1A-2); Podoplanin

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us