Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PRRT2 (Proline rich transmembrane protein 2) Expressed in E.coli for Antibody Discovery, Partial (1-268aa) (CAT#: MPX0108K)

This product is a 30 kDa Human PRRT2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PRRT2
  • Protein Length
  • Partial (1-268aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 30 kDa
  • TMD
  • 2
  • Sequence
  • MGSSHHHHHHSSGLVPRGSHMGSMAASSSEISEMKGVEESPKVPGEGPGHSEAETGPPQVLAGVPDQPEAPQPGPNTTAAPVDSGPKAGLAPETTETPAGASETAQATDLSLSPGGESKANCSPEDPCQETVSKPEVSKEATADQGSRLESAAPPEPAPEPAPQPDPRPDSQPTPKPALQPELPTQEDPTPEILSESVGEKQENGAVVPLQAGDGEEGPAPEPHSPPSKKSPPANGAPPRVLQQLVEEDRMRRAHSGHPGSPRGSLSRHPSSQLAGPGVEGGEGTQKPRDY

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • His tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • > 85% SDS-PAGE
  • Buffer
  • pH: 8.00, Constituents: 0.32% Tris-HCl buffer, 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.02% DTT

Target

  • Target Protein
  • PRRT2
  • Full Name
  • Proline rich transmembrane protein 2
  • Introduction
  • This gene encodes a transmembrane protein containing a proline-rich domain in its N-terminal half. Studies in mice suggest that it is predominantly expressed in brain and spinal cord in embryonic and postnatal stages. Mutations in this gene are associated with episodic kinesigenic dyskinesia-1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • PRRT2; PKC; EKD1; ICCA; BFIC2; BFIS2; DSPB3; DYT10; FICCA; IFITMD1; proline-rich transmembrane protein 2; dispanin subfamily B member 3; dystonia 10; infantile convulsions and paroxysmal choreoathetosis; interferon induced transmembrane protein domain containing 1; Proline rich transmembrane protein 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us