Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PSENEN (Presenilin enhancer, gamma-secretase subunit) Full Length (CAT#: MPC1319K) Made to Order

This product is a 12 kDa Human PSENEN membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PSENEN
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 12 kDa
  • TMD
  • 2
  • Sequence
  • MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQ
    SQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGT
    P

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • PSENEN
  • Full Name
  • Presenilin enhancer, gamma-secretase subunit
  • Introduction
  • Presenilins, which are components of the gamma-secretase protein complex, are required for intramembranous processing of some type I transmembrane proteins, such as the Notch proteins and the beta-amyloid precursor protein. Signaling by Notch receptors mediates a wide range of developmental cell fates. Processing of the beta-amyloid precursor protein generates neurotoxic amyloid beta peptides, the major component of senile plaques associated with Alzheimer's disease. This gene encodes a protein that is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2). Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • PSENEN; PEN2; PEN-2; MDS033; ACNINV2; MSTP064; gamma-secretase subunit PEN-2; hematopoietic stem/progenitor cells protein MDS033; presenilin enhancer 2 homolog; Presenilin enhancer, gamma-secretase subunit

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us