Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human RAET1G (Retinoic acid early transcript 1G) Expressed in CHO for Antibody Discovery, Partial (1-210aa) (CAT#: MPX0323K)

This product is a 21.5 kDa Human RAET1G membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • RAET1G
  • Protein Length
  • Partial (1-210aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 21.5 kDa
  • TMD
  • 1
  • Sequence
  • MAAAASPAFLLRLPLLLLLSSWCRTGLADPHSLCYDITVIPKFRPGPRWC
    AVQGQVDEKTFLHYDCGSKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDI
    LTEQLLDIQLENYIPKEPLTLQARMSCEQKAEGHGSGSWQLSFDGQIFLL
    FDSENRMWTTVHPGARKMKEKWENDKDMTMSFHYISMGDCTGWLEDFLMG
    MDSTLEPSAG

Product Description

  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • RAET1G
  • Full Name
  • Retinoic acid early transcript 1G
  • Introduction
  • This gene encodes a member of the major histocompatibility complex (MHC) class I family of proteins. Although the encoded protein includes C-terminal transmembrane and cytoplasmic domains, proteolytic processing results in the removal of these domains and subsequent tethering to the plasma membrane by a glycosylphosphatidylinositol (GPI)-anchor. The encoded protein is one of several related ligands of the natural killer group 2, member D (NKG2D) receptor, which functions as an activating receptor in innate and adaptive immunity. This gene is present in a gene cluster on chromosome 6.
  • Alternative Names
  • RAET1G; ULBP5; UL-16 binding protein 5; retinoic acid early transcript 1G protein; Retinoic acid early transcript 1G

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us