Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SDC4 (Syndecan 4) Full Length (CAT#: MPC2008K) Made to Order

This product is a 21.6 kDa Human SDC4 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SDC4
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 21.6 kDa
  • TMD
  • 1
  • Sequence
  • MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVG
    PGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVP
    TEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEVLAAL
    IVGGIVGILFAVFLILLLMYRMKKKDEGSYDLGKKPIYKKAPTNEFYA

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SDC4
  • Full Name
  • Syndecan 4
  • Introduction
  • The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan that functions as a receptor in intracellular signaling. The encoded protein is found as a homodimer and is a member of the syndecan proteoglycan family. This gene is found on chromosome 20, while a pseudogene has been found on chromosome 22.
  • Alternative Names
  • SDC4; SYND4; syndecan-4; amphiglycan; ryudocan amphiglycan; ryudocan core protein; syndecan 4 (amphiglycan, ryudocan); syndecan proteoglycan 4; Syndecan 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us