Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TACSTD2 (Tumor associated calcium signal transducer 2) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX3811K)

This product is a Human TACSTD2 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TACSTD2
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • TACSTD2
  • Full Name
  • Tumor associated calcium signal transducer 2
  • Introduction
  • This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.
  • Alternative Names
  • TACSTD2; EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1; tumor-associated calcium signal transducer 2; 40kD glycoprotein, identified by monoclonal antibody GA733; cell surface glycoprotein TROP2; cell surface glycoprotein Trop-2; epithelial glycoprotein-1; gastrointestinal tumor-associated antigen GA7331; membrane component, chromosome 1, surface marker 1; pancreatic carcinoma marker protein GA733-1; pancreatic carcinoma marker protein GA7331; trophoblast cell surface antigen 2; truncated TACSTD2; Tumor associated calcium signal transducer 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us