Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SIT1 (Signaling threshold regulating transmembrane adaptor 1) expressed in E.coli for Antibody Discovery (CAT#: MP1134X)

This product is a 16.9 kDa Human SIT1 membrane protein expressed in E. coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SIT1
  • Protein Length
  • Full-length
  • Molecular Weight
  • 16.9 kDa
  • TMD
  • 1
  • Sequence
  • MGSSHHHHHHSSGLVPRGSHMHLSQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAAS

Product Description

  • Application
  • SDS-PAGE
  • Expression Systems
  • E. coli
  • Tag
  • His tag
  • Purity
  • > 90% by SDS-PAGE
  • Buffer
  • 20 mM Tris-HCl buffer, pH 8.0 (20% glycerol)

Target

  • Target Protein
  • SIT1
  • Full Name
  • Signaling threshold regulating transmembrane adaptor 1
  • Introduction
  • Negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells. Involved in positive selection of T-cells.
  • Alternative Names
  • SIT; SIT-R; signaling threshold-regulating transmembrane adapter 1; SHP-2 interacting transmembrane adaptor protein; SHP2 interacting transmembrane adaptor; SHP2-interacting transmembrane adapter protein; SHP2-interacting transmembrane adaptor protein; gp30/40; suppression inducing transmembrane adaptor 1; suppression-inducing transmembrane adapter 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us