Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC1A6 (Solute carrier family 1 member 6) Expressed in E.coli with GST tag at the N-terminus for Antibody Discovery, Partial (149-271aa) (CAT#: MPX4592K)

This product is a 40.4kDa Human SLC1A6 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC1A6
  • Protein Length
  • Partial (149-271aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 40.4kDa
  • TMD
  • 8
  • Sequence
  • MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • SLC1A6
  • Full Name
  • Solute carrier family 1 member 6
  • Alternative Names
  • SLC1A6; EAAT4; excitatory amino acid transporter 4; sodium-dependent glutamate/aspartate transporter; solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6; Solute carrier family 1 member 6

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us