Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human GYPE (Glycophorin E (MNS blood group)) Full Length (CAT#: MPC1838K) Made to Order

This product is a 8.4 kDa Human GYPE membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • GYPE
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 8.4 kDa
  • TMD
  • 1
  • Sequence
  • MYGKIIFVLLLSGIVSISASSTTGVAMHTSTSSSVTKSYISSQTNGITLI
    NWWAMARVIFEVMLVVVGMIILISYCIR

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • GYPE
  • Full Name
  • Glycophorin E (MNS blood group)
  • Introduction
  • The protein encoded by this gene is a sialoglycoprotein and a type I membrane protein. It is a member of a gene family with GPA and GPB genes. This encoded protein might carry the M blood group antigen. GYPA, GYPB, and GYPE are organized in tandem on chromosome 4. This gene might have derived from an ancestral gene common to the GPB gene by gene duplication. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.
  • Alternative Names
  • GYPE; GPE; MNS; GYPA; MiIX; glycophorin-E; glycophorin A; Glycophorin E (MNS blood group)

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us