Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC25A26 (Solute carrier family 25 member 26) Full Length (CAT#: MPC1926K) Made to Order

This product is a 29.3 kDa Human SLC25A26 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC25A26
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 29.3 kDa
  • TMD
  • 6
  • Sequence
  • MDRPGFVAALVAGGVAGVSVDLILFPLDTIKTRLQSPQGFSKAGGFHGIY
    AGVPSAAIGSFPNAAAFFITYEYVKWFLHADSSSYLTPMKHMLAASAGEV
    VACLIRVPSEVVKQRAQVSASTRTFQIFSNILYEEGIQGLYRGYKSTVLR
    EIPFSLVQFPLWESLKALWSWRQDHVVDSWQSAVCGAFAGGFAAAVTTPL
    DVAKTRITLAKAGSSTADGNVLSVLHGVWRSQGLAGLFAGVFPRMAAISL
    GGFIFLGAYDRTHSLLLEVGRKSP

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SLC25A26
  • Full Name
  • Solute carrier family 25 member 26
  • Introduction
  • This gene is a member of the mitochondrial carrier family which includes nuclear-encoded transporters localized on the inner mitochondrial membranes. Members of the family transport important small molecules across the mitochondrial inner membrane. This protein is involved in the transport of S-adenosylmethionine (SAM) into the mitochondria. Mutations in this gene are associated with combined oxidative phosphorylation deficiency 28. Alternative splicing results in multiple transcript variants encoding different isoforms.
  • Alternative Names
  • SLC25A26; SAMC; COXPD28; S-adenosylmethionine mitochondrial carrier protein; mitochondrial S-adenosylmethionine transporter; solute carrier family 25 (S-adenosylmethionine carrier), member 26; solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 26; Solute carrier family 25 member 26

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us