Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC35G4 (Solute carrier family 35 member G4) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX3376K)

This product is a Human SLC35G4 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC35G4
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 7
  • Sequence
  • MAGSHPYFNLPDSTHPSPPSTPPSLHWHQRCQPSDATNGLLVALLGGGLPAGFVGPLSRMAYQASNLPSLELVICRCLFHLPIALLLKLRGDPLLGPPDIRGRTCFCALLNVLNIGCAYSAVQVVPTGNAATVRKHSSTVCSAILTLCLESQVLSGYDWCGLLGSILGLIIIVGPGLWTLQEGTTGVYTGLGYVQAFLGGLALSLGLLVYRSLHFPSCLPTVAFLSGLVGLLGSVPGLFVLQSPVLPSDLLSWSCVGAVGILTLVSFTCVGYAVTKAHPALVCAVLHSEVVMALILQYFMLHETVAPSDIMGAGVVLGSIAIITARNLICERTGKVEE

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • SLC35G4
  • Full Name
  • Solute carrier family 35 member G4
  • Alternative Names
  • SLC35G4; AMAC1L1; SLC35G4P; putative solute carrier family 35 member G4; acyl-malonyl-condensing enzyme 1-like protein 1; protein AMAC1L1; putative solute carrier family 35 member G4 pseudogene; solute carrier family 35, member G4, pseudogene; Solute carrier family 35 member G4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us