Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC39A3 (Solute carrier family 39 member 3) for Antibody Discovery (CAT#: MP1235X)

This product is a 37.29 kDa Human SLC39A3 membrane protein expressed in In vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC39A3
  • Protein Length
  • Full-length
  • Molecular Weight
  • 37.29 kDa
  • TMD
  • 8
  • Sequence
  • MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCFNALLPAVREKVRAPWALAAALGTLWPRDSDAFSTLMPSSVKALML

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Protein Format
  • Liposome
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0

Target

  • Target Protein
  • SLC39A3
  • Full Name
  • Solute carrier family 39 member 3
  • Introduction
  • The SLC39A3 gene is conserved in chimpanzee, dog, cow, mouse, rat, chicken, fruit fly, mosquito, and frog.
  • Alternative Names
  • ZIP3; ZIP-3; zinc transporter ZIP3; solute carrier family 39 (zinc transporter), member 3; zrt- and Irt-like protein 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us