Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC50A1 (Solute carrier family 50 member 1) expressed in In vitro wheat germ expression system for Antibody Discovery (CAT#: MP1073X)

This product is a 45.4 kDa Human SLC50A1 membrane protein expressed in In vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC50A1
  • Protein Length
  • Full-length
  • Molecular Weight
  • 45.4 kDa
  • TMD
  • 7
  • Sequence
  • MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDGILIVVNTVGAALQTLYILAYLHYCPRKAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWLLQT

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • In vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0

Target

  • Target Protein
  • SLC50A1
  • Full Name
  • Solute carrier family 50 member 1
  • Introduction
  • Mediates sugar transport across membranes. May stimulate V(D)J recombination by the activation of RAG1.
  • Alternative Names
  • SCP; slv; SWEET1; RAG1AP1; HsSWEET1; sugar transporter SWEET1; RAG1-activating protein 1; RP11-540D14.5; RZPDo834D038D; probable sugar transporter RAG1AP1; recombination activating gene 1 activating protein 1; solute carrier family 50 (sugar efflux transporter), member 1; solute carrier family 50 (sugar transporter), member 1; stromal cell protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us