Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC7A5P1 (Solute carrier family 7 member 5 pseudogene 1) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1283K)

This product is a Human SLC7A5P1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC7A5P1
  • Protein Length
  • Full Length
  • Protein Class
  • Transport
  • TMD
  • 3
  • Sequence
  • MAGAGPKRRALAAPVAEEKEEAREKMLASKRADGAAPAGEGEGVTLQRNITLLNGVAIIVGAIIGSGIFVTPTGVLKEAGSPGLALVMWAACGVFSIVGALCYAELGTTISKSGGDYAYMLDVYGSLPAFLKLWIELLVIRPSSQYIVALVFATYLLKPLFPSCPVPEEAAKLMACHCVH

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • SLC7A5P1
  • Full Name
  • Solute carrier family 7 member 5 pseudogene 1
  • Introduction
  • This locus represents a pseudogene of the L-type amino acid transporter 1. Transcripts initiating at this locus read through to downstream SMG1 pseudogene 2 (SMG1P2).
  • Alternative Names
  • SLC7A5P1; DC49; MLAS; LAT1-3TM; hLAT1-3TM; SLC7A5 pseudogene; hLAT1 3-transmembrane protein MLAS; putative L-type amino acid transporter 1-like protein MLAS; solute carrier family 7 (amino acid transporter light chain, L system), member 5 pseudogene 1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 5 pseudogene 1; Solute carrier family 7 member 5 pseudogene 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us