Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SURF1 (SURF1 cytochrome c oxidase assembly factor) Full Length (CAT#: MPC1452K) Made to Order

This product is a 33.3 kDa Human SURF1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SURF1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 33.3 kDa
  • TMD
  • 2
  • Sequence
  • MAAVAALQLGLRAAGLGRAPASAAWRSVLRVSPRPGVAWRPSRCGSSAAE
    ASATKAEDDSFLQWVLLLIPVTAFGLGTWQVQRRKWKLNLIAELESRVLA
    EPVPLPADPMELKNLEYRPVKVRGCFDHSKELYMMPRTMVDPVREAREGG
    LISSSTQSGAYVVTPFHCTDLGVTILVNRGFVPRKKVNPETRQKGQIEGE
    VDLIGMVRLTETRQPFVPENNPERNHWHYRDLEAMARITGAEPIFIDANF
    QSTVPGGPIGGQTRVTLRNEHLQYIVTWYGLSAATSYLWFKKFLRGTPGV

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SURF1
  • Full Name
  • SURF1 cytochrome c oxidase assembly factor
  • Introduction
  • This gene encodes a protein localized to the inner mitochondrial membrane and thought to be involved in the biogenesis of the cytochrome c oxidase complex. The protein is a member of the SURF1 family, which includes the related yeast protein SHY1 and rickettsial protein RP733. The gene is located in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity, where it shares a bidirectional promoter with SURF2 on the opposite strand. Defects in this gene are a cause of Leigh syndrome, a severe neurological disorder that is commonly associated with systemic cytochrome c oxidase deficiency.
  • Alternative Names
  • SURF1; SHY1; CMT4K; MC4DN1; surfeit locus protein 1; SURF1 cytochrome c oxidase assembly factor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us