Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SYS1 (SYS1 golgi trafficking protein) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2115K)

This product is a Human SYS1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SYS1
  • Protein Length
  • Full Length
  • Protein Class
  • Transport
  • TMD
  • 4
  • Sequence
  • MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFSTPPGRLSMMSFILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWWLVQAVCIALMAVIGEYLCMRTELKEIPLNSAPKSNV

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • SYS1
  • Full Name
  • SYS1 golgi trafficking protein
  • Introduction
  • SYS1 forms a complex with ADP-ribosylation factor-related protein ARFRP1 (MIM 604699) and targets ARFRP1 to the Golgi apparatus.
  • Alternative Names
  • SYS1; C20orf169; dJ453C12.4; dJ453C12.4.1; protein SYS1 homolog; SYS1 Golgi-localized integral membrane protein homolog; SYS1 golgi trafficking protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us