Discovery
- Services
  Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
  Highlights
  - Discovery Services
  - Engineering Services
Characterization
- Services
  Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
  Highlights
  - Discovery Services
  - Engineering Services
Engineering
- Services
  Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
  Highlights
  - Discovery Services
  - Engineering Services
Custom Production & Manufacturing
- - Custom Production
    
    Membrane Protein Preparation
    
    GPCR Preparation
    
    Ion Channel Preparation
    
    Transporter Preparation
    
    Custom Membrane Protein Production
    
    Custom Membrane Protein Solubilization & Stabilization
    
    Custom Membrane Protein QC
    
    Virus Like Particle Production
    
    Insect Cell based VLP Production
    
    Mammalian Cell based VLP Production
    
    E. coli based VLP Production
    
    Yeast Cell based VLP Production
    
    Plant Cell based VLP Production
    
    Recombinant Antibody Production
    
    Ascite Fluid based Antibody Production
    
    Stable Cell Line Construction
  - Manufacturing
    
    Manufacturability Assessment & Optimization
    
    Virtual Prediction
    
    Amino Acid & Terminal Sequence Analysis
- Services
  Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
  Highlights
  - Discovery Services
  - Engineering Services
Products
- Products
  With over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications.
Platforms
- Platforms
  Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
  Highlights
  - B-Cell Sorting Platform
  - Phage Display Platform
Resources
- Resources
  With deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
  Highlights
  - Peer-Reviewed Publications
  - Support Documents
Company
- About Us
  Get a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
  Highlights
  - About Us
  - Contact Us

Product Service Keyword

Online Inquiry

	: : :
	Call us at: : : :
	Fax:
	Email:

MemDX™ Membrane Protein Human TAAR1 (Trace amine associated receptor 1) for Antibody Discovery (CAT#: MP1321X)

Name: MemDX™ Membrane Protein Human TAAR1 (Trace amine associated receptor 1) for Antibody Discovery
SKU: MP1321X
Rating: 5 (1 reviews)

Datasheet

This product is a 65.5 kDa Human TAAR1 membrane protein expressed in In vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

Host Species
Human

Target Protein
TAAR1

Protein Length
Full-length

Molecular Weight
65.5 kDa

Sequence
MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS

Product Description

Application
Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array

Expression Systems
in vitro wheat germ expression system

Tag
GST-tag at N-terminal

Protein Format
Liposome

Purification
Glutathione Sepharose 4 Fast Flow

Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0

Target

Target Protein
TAAR1

Full Name
Trace amine associated receptor 1

Introduction
The protein encoded by this gene is a G-protein coupled receptor activated by trace amines. The encoded protein responds little or not at all to dopamine, serotonin, epinephrine, or histamine, but responds well to beta-phenylethylamine, p-tyramine, octopamine, and tryptamine. While primarily functioning in neurologic systems, there is evidence that this gene is involved in blood cell and immunologic functions as well. This gene is thought to be intronless.

Alternative Names
TA1; TAR1; TRAR1; trace amine-associated receptor 1; trace amine receptor 1

Gene ID
134864

UniProt ID
Q96RJ0

Case Studies

Customer reviews and Q&As Write a review Ask a question

Related Products

CAT
Product Name