Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TARM1 (T cell-interacting, activating receptor on myeloid cells 1) Expressed in CHO for Antibody Discovery, Partial (17-235aa) (CAT#: MPX0837K)

This product is a 50 kDa Human TARM1 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TARM1
  • Protein Length
  • Partial (17-235aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 50 kDa
  • TMD
  • 1
  • Sequence
  • QGDTRGDGSLPKPSLSAWPSSVVPANSNVTLRCWTPARGVSFVL
    RKGGIILESPKPLDSTEGAAEFHLNNLKVRNAGEYTCEYYRKASPHILSQHSDVLLLLVT
    GHLSKPFLRTYQRGTVTAGGRVTLQCQKRDQLFVPIMFALLKAGTPSPIQLQSPAGKEID
    FSLVDVTAGDAGNYSCMYYQTKSPFWASEPSDQLEILVTVPPGTTSSNYSLGNFV

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • TARM1
  • Full Name
  • T cell-interacting, activating receptor on myeloid cells 1
  • Alternative Names
  • TARM1; OLT-2; T-cell-interacting, activating receptor on myeloid cells protein 1; OSCAR-like transcript-2 protein; T cell-interacting, activating receptor on myeloid cells 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us