Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TGFA (Transforming growth factor alpha) Full Length (CAT#: MPC2031K) Made to Order

This product is a 17 kDa Human TGFA membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TGFA
  • Protein Length
  • Full length
  • Protein Class
  • Growth factor
  • Molecular Weight
  • 17 kDa
  • TMD
  • 1
  • Sequence
  • MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDS
    HTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAI
    TALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGR
    TACCHSETVV

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TGFA
  • Full Name
  • Transforming growth factor alpha
  • Introduction
  • This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • TGFA; TFGA; protransforming growth factor alpha; TGF-alpha; Transforming growth factor alpha

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us