Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TIMM17A (Translocase of inner mitochondrial membrane 17A) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1258K)

This product is a Human TIMM17A membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TIMM17A
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 3
  • Sequence
  • MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis and SUMO tag
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • TIMM17A
  • Full Name
  • Translocase of inner mitochondrial membrane 17A
  • Alternative Names
  • TIMM17A; TIM17; TIM17A; mitochondrial import inner membrane translocase subunit Tim17-A; inner membrane preprotein translocase Tim17a; mitochondrial inner membrane translocase; preprotein translocase; translocase of inner mitochondrial membrane 17 homolog A; Translocase of inner mitochondrial membrane 17A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us