Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human LILRA2 (Leukocyte immunoglobulin like receptor A2) Expressed in HEK293 for Antibody Discovery, Partial (24-449aa) (CAT#: MPX0606K)

This product is a 48 kDa Human LILRA2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • LILRA2
  • Protein Length
  • Partial (24-449aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 48 kDa
  • TMD
  • 1
  • Sequence
  • GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHL
    YRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAY
    SKPTLSALPSPVVTSGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIF
    SVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESL
    TLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHN
    LSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGA
    GHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEA
    AETLSPSQNKTDSTTTSLGQHPQDYTVEN

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • LILRA2
  • Full Name
  • Leukocyte immunoglobulin like receptor A2
  • Introduction
  • This gene encodes a member of a family of immunoreceptors that are expressed predominantly on monocytes and B cells, and at lower levels on dendritic cells and natural killer cells. The encoded protein is an activating receptor that inhibits dendritic cell differentiation and antigen presentation and suppresses innate immune response. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and there is a pseudogene for this gene on chromosome 3.
  • Alternative Names
  • LILRA2; ILT1; LIR7; CD85H; LIR-7; leukocyte immunoglobulin-like receptor subfamily A member 2; CD85 antigen-like family member H; immunoglobulin-like transcript 1; leucocyte Ig-like receptor A2; leukocyte immunoglobulin-like receptor 7; leukocyte immunoglobulin-like receptor subfamily A member 2 soluble; leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2; Leukocyte immunoglobulin like receptor A2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us