Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TNFSF4 (TNF superfamily member 4, 51-183aa) for Antibody Discovery (CAT#: MP1491J)

This product is a 16.3 kDa Human TNFSF4 membrane protein expressed in Mammalian cell. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFSF4
  • Protein Length
  • Partial (51-183aa)
  • Protein Class
  • Immune Checkpoints
  • Molecular Weight
  • 16.3 kDa
  • TMD
  • 1
  • Sequence
  • QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Product Description

  • Activity
  • Yes
  • Expression Systems
  • Mammalian cell
  • Tag
  • N-6xHis
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Endotoxin
  • <1.0 EU/μg
  • Purity
  • >95% as determined by SDS-PAGE
  • Buffer
  • 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Target

  • Target Protein
  • TNFSF4
  • Full Name
  • TNF superfamily member 4
  • Introduction
  • Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
  • Alternative Names
  • CD 134L; CD 252; CD134 ligand; CD134L; CD252; CD252 antigen; glycoprotein 34 kd; Glycoprotein Gp34; GP34; OX-40L; OX40 antigen ligand; OX40 ligand; OX40L; TAX transcriptionally-activated glycoprotein 1; TNFL4_HUMAN; Tnfsf4; Tumor necrosis factor (ligand) superfamily member 4; Tumor necrosis factor ligand superfamily member 4; TXGP1; TNLG2B

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us