Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TOMM22 (Translocase of outer mitochondrial membrane 22) Full Length (CAT#: MPC1923K) Made to Order

This product is a 15.5 kDa Human TOMM22 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TOMM22
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 15.5 kDa
  • TMD
  • 1
  • Sequence
  • MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWG
    LTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVV
    FETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TOMM22
  • Full Name
  • Translocase of outer mitochondrial membrane 22
  • Introduction
  • The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion.
  • Alternative Names
  • TOMM22; 1C9-2; TOM22; MST065; MSTP065; mitochondrial import receptor subunit TOM22 homolog; mitochondrial import receptor Tom22; translocase of outer membrane 22 kDa subunit homolog; translocase of outer mitochondrial membrane 22 homolog; Translocase of outer mitochondrial membrane 22

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us