Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TOMM7 (Translocase of outer mitochondrial membrane 7) Full Length (CAT#: MPC2563K) Made to Order

This product is a made-to-order Human TOMM7 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TOMM7
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • TMD
  • 1
  • Sequence
  • MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVL
    SLLWG

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • TOMM7
  • Full Name
  • Translocase of outer mitochondrial membrane 7
  • Introduction
  • This gene encodes a subunit of the translocase of the outer mitochondrial membrane. The encoded protein regulates the assembly and stability of the translocase complex.
  • Alternative Names
  • TOMM7; TOM7; mitochondrial import receptor subunit TOM7 homolog; translocase of outer membrane 7 kDa subunit homolog; translocase of outer mitochondrial membrane 7 homolog; Translocase of outer mitochondrial membrane 7

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us