Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TSPAN31 (Tetraspanin 31) Full Length (CAT#: MPC1940K) Made to Order

This product is a 23 kDa Human TSPAN31 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TSPAN31
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 23 kDa
  • TMD
  • 4
  • Sequence
  • MVCGGFACSKNALCALNVVYMLVSLLLIGVAAWGKGLGLVSSIHIIGGVI
    AVGVFLLLIAVAGLVGAVNHHQVLLFFYMIILGLVFIFQFVISCSCLAIN
    RSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAIC
    KSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMRFRNQK
    DPRANPSAFL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TSPAN31
  • Full Name
  • Tetraspanin 31
  • Introduction
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma.
  • Alternative Names
  • TSPAN31; SAS; tetraspanin-31; sarcoma-amplified sequence; transmembrane 4 protein; tspan-31; Tetraspanin 31

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us