Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human UGT2B7 (UDP glucuronosyltransferase family 2 member B7) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX3949K)

This product is a Human UGT2B7 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • UGT2B7
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Transferase
  • TMD
  • 1
  • Sequence
  • GKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVLGRPTTLSETMGKADVWLIRNSWNFQFPHPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSGENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTMSSTDLLNALKRVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKKGKND

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • UGT2B7
  • Full Name
  • UDP glucuronosyltransferase family 2 member B7
  • Introduction
  • The protein encoded by this gene belongs to the UDP-glycosyltransferase (UGT) family. UGTs serve a major role in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This protein is localized in the microsome membrane, and has unique specificity for 3,4-catechol estrogens and estriol, suggesting that it may play an important role in regulating the level and activity of these potent estrogen metabolites. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • UGT2B7; UGT2B9; UDPGTH2; UDPGT2B7; UDPGTh-2; UDPGT 2B7; UDPGT 2B9; UDP-glucuronosyltransferase 2B7; UDP glucuronosyltransferase family 2 member B7

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us