Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human UNC5B (Unc-5 netrin receptor B) Expressed in CHO for Antibody Discovery, Partial (27-377aa) (CAT#: MPX0473K)

This product is a 66 kDa Human UNC5B membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • UNC5B
  • Protein Length
  • Partial (27-377aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 66 kDa
  • TMD
  • 1
  • Sequence
  • GTDSGSEVLPDSFPSAPAEPLPYF
    LQEPQDAYIVKNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGLDEA
    TGLRVREVQIEVSRQQVEELFGLEDYWCQCVAWSSAGTTKSRRAYVRIAY
    LRKNFDQEPLGKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPTQDT
    NFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWS
    SWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTICP
    VDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTD
    GLCMQNKKTLSDPNSHLLEASGDAALY

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 400 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE with silver staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • UNC5B
  • Full Name
  • Unc-5 netrin receptor B
  • Introduction
  • This gene encodes a member of the netrin family of receptors. This particular protein mediates the repulsive effect of netrin-1 and is a vascular netrin receptor. This encoded protein is also in a group of proteins called dependence receptors (DpRs) which are involved in pro- and anti-apoptotic processes. Many DpRs are involved in embryogenesis and in cancer progression. Two alternatively spliced transcript variants have been described for this gene.
  • Alternative Names
  • UNC5B; UNC5H2; p53RDL1; netrin receptor UNC5B; p53-regulated receptor for death and life protein 1; protein unc-5 homolog 2; protein unc-5 homolog B; transmembrane receptor Unc5H2; unc-5 homolog 2; unc-5 homolog B; Unc-5 netrin receptor B

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us