Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human UNC5C (Unc-5 netrin receptor C) Expressed in NS0 for Antibody Discovery, Partial (40-376aa) (CAT#: MPX0113K)

This product is a 64.6 kDa Human UNC5C membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • UNC5C
  • Protein Length
  • Partial (40-376aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 64.6 kDa
  • TMD
  • 1
  • Sequence
  • AQDDDFFHELP
    ETFPSDPPEPLPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWV
    HQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSSA
    GTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVE
    WLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKS
    TTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCE
    GQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGK
    DCDGLVLQSKNCTDGLCMQTAPDSDD

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • UNC5C
  • Full Name
  • Unc-5 netrin receptor C
  • Introduction
  • This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
  • Alternative Names
  • UNC5C; UNC5H3; netrin receptor UNC5C; protein unc-5 homolog 3; protein unc-5 homolog C; unc-5 homolog 3; unc-5 homolog C; unc5 (C.elegans homolog) c; Unc-5 netrin receptor C

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us