Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human UQCR11 (Ubiquinol-cytochrome c reductase, complex III subunit XI) Full Length (CAT#: MPC2165K) Made to Order

This product is a 6.5 kDa Human UQCR11 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • UQCR11
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 6.5 kDa
  • TMD
  • 1
  • Sequence
  • MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYING
    KFKKDN

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • UQCR11
  • Full Name
  • Ubiquinol-cytochrome c reductase, complex III subunit XI
  • Introduction
  • This gene encodes the smallest known component of the ubiquinol-cytochrome c reductase complex, which forms part of the mitochondrial respiratory chain. The encoded protein may function as a binding factor for the iron-sulfur protein in this complex.
  • Alternative Names
  • UQCR11; UQCR; QCR10; 0710008D09Rik; cytochrome b-c1 complex subunit 10; complex III subunit 10; complex III subunit XI; ubiquinol-cytochrome c reductase complex 6.4 kDa protein; ubiquinol-cytochrome c reductase, 6.4kDa subunit; Ubiquinol-cytochrome c reductase, complex III subunit XI

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us