Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human VAMP2 (Vesicle associated membrane protein 2) Full Length (CAT#: MPC0978K) Made to Order

This product is a 12.6 kDa Human VAMP2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • VAMP2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 12.6 kDa
  • TMD
  • 1
  • Sequence
  • MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNV
    DKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILG
    VICAIILIIIIVYFST

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • VAMP2
  • Full Name
  • Vesicle associated membrane protein 2
  • Introduction
  • The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. This gene is thought to participate in neurotransmitter release at a step between docking and fusion. The protein forms a stable complex with syntaxin, synaptosomal-associated protein, 25 kD, and synaptotagmin. It also forms a distinct complex with synaptophysin. It is a likely candidate gene for familial infantile myasthenia (FIMG) because of its map location and because it encodes a synaptic vesicle protein of the type that has been implicated in the pathogenesis of FIMG.
  • Alternative Names
  • SYB2; VAMP-2; NEDHAHM; vesicle-associated membrane protein 2; synaptobrevin 2; VAMP2; Vesicle associated membrane protein 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us