Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human VDAC1 (Voltage dependent anion channel 1) Full Length (CAT#: MPC1029K) Made to Order

This product is a 30.7 kDa Human VDAC1 membrane protein expressed in Cell-free in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • VDAC1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 30.7 kDa
  • TMD
  • 19
  • Sequence
  • MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTE
    TTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFD
    SSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWL
    AGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNK
    KLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQT
    LKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA

Product Description

  • Expression Systems
  • Cell-free in E.coli
  • Tag
  • His tag at N-terminal
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • VDAC1
  • Full Name
  • Voltage dependent anion channel 1
  • Introduction
  • This gene encodes a voltage-dependent anion channel protein that is a major component of the outer mitochondrial membrane. The encoded protein facilitates the exchange of metabolites and ions across the outer mitochondrial membrane and may regulate mitochondrial functions. This protein also forms channels in the plasma membrane and may be involved in transmembrane electron transport. Alternate splicing results in multiple transcript variants. Multiple pseudogenes of this gene are found on chromosomes 1, 2 3, 6, 9, 12, X and Y.
  • Alternative Names
  • VDAC1; PORIN; VDAC-1; voltage-dependent anion-selective channel protein 1; outer mitochondrial membrane protein porin 1; plasmalemmal porin; porin 31HL; porin 31HM; sperm binding protein 1a; hVDAC1; VDAC; Voltage dependent anion channel 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us