Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human VSIG1 (V-set and immunoglobulin domain containing 1) Expressed in Mammalian cell expression system with 10xHis tag at the N-terminus for Antibody Discovery, Partial (22-232aa) (CAT#: MPX4692K)

This product is a 26.4 kDa Human VSIG1 membrane protein expressed in Mammalian cell expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • VSIG1
  • Protein Length
  • Partial (22-232aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 26.4 kDa
  • TMD
  • 1
  • Sequence
  • VQVTIPDGFVNVTVGSNVTLICIYTTTVASREQLSIQWSFFHKKEMEPISIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNFEQGYYQCTAINRLGNSSCEIDLTSSHPE

Product Description

  • Expression Systems
  • Mammalian cell expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • VSIG1
  • Full Name
  • V-set and immunoglobulin domain containing 1
  • Introduction
  • This gene encodes a member of the junctional adhesion molecule (JAM) family. The encoded protein contains multiple glycosylation sites at the N-terminal region, and multiple phosphorylation sites and glutamic acid/proline (EP) repeats at the C-terminal region. The gene is expressed in normal stomach and testis, as well as in gastric, esophageal and ovarian cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • GPA34; dJ889N15.1; 1700062D20Rik; V-set and immunoglobulin domain-containing protein 1; cell surface A33 antigen; glycoprotein A34

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us