Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human XCR1 (X-C motif chemokine receptor 1) for Antibody Discovery (CAT#: MP1366J)

This product is a 38.5 kDa Human XCR1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • XCR1
  • Protein Length
  • Full-length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 38.5 kDa
  • TMD
  • 7
  • Sequence
  • MESSGNPESTTFFYYDLQSQPCENQAWVFATLATTVLYCLVFLLSLVGNSLVLWVLVKYE SLESLTNIFILNLCLSDLVFACLLPVWISPYHWGWVLGDFLCKLLNMIFSISLYSSIFFL TIMTIHRYLSVVSPLSTLRVPTLRCRVLVTMAVWVASILSSILDTIFHKVLSSGCDYSEL TWYLTSVYQHNLFFLLSLGIILFCYVEILRTLFRSRSKRRHRTVKLIFAIVVAYFLSWGP YNFTLFLQTLFRTQIIRSCEAKQQLEYALLICRNLAFSHCCFNPVLYVFVGVKFRTHLKH VLRQFWFCRLQAPSPASIPHSPGAFAYEGASFY

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-10xHis
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • XCR1
  • Full Name
  • X-C motif chemokine receptor 1
  • Introduction
  • The protein encoded by this gene is a chemokine receptor belonging to the G protein-coupled receptor superfamily. The family members are characterized by the presence of 7 transmembrane domains and numerous conserved amino acids. This receptor is most closely related to RBS11 and the MIP1-alpha/RANTES receptor. It transduces a signal by increasing the intracellular calcium ions level. The viral macrophage inflammatory protein-II is an antagonist of this receptor and blocks signaling. Several alternatively spliced transcript variants encoding the same protein have been found for this gene.
  • Alternative Names
  • CCXCR 1; Chemokine (C motif) receptor 1; Chemokine (C motif) XC receptor 1; Chemokine XC receptor 1; G protein coupled receptor 5; G-protein coupled receptor 5; GPR5; lptn receptor; Lymphotactin receptor; XC chemokine receptor 1; XCR 1; XCR1; XCR1_HUMAN

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us