Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human YWHAQ (Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta) for Antibody Discovery (CAT#: MP1400J)

This product is a 54.8 kDa Human YWHAQ membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • YWHAQ
  • Protein Length
  • Full-length
  • Protein Class
  • Ion Channel
  • Molecular Weight
  • 54.8 kDa
  • Sequence
  • MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-GST
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • YWHAQ
  • Full Name
  • Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta
  • Introduction
  • This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.
  • Alternative Names
  • 14-3-3 protein T cell; 14-3-3 protein T-cell; 14-3-3 protein tau; 14-3-3 protein theta; 1433T_HUMAN; IC5; Protein HS1; Protein tau; YWHAQ tyrosine 3 monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide; Ywhaq; 1C5; HS1; 14-3-3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us