Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Influenza A virus M (Matrix protein 2) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0932K)

This product is a Influenza A virus M membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Influenza A virus
  • Target Protein
  • M
  • Protein Length
  • Full Length
  • Protein Class
  • Virus
  • Molecular Weight
  • 15.1kDa
  • TMD
  • 1
  • Sequence
  • MSLLTEVETPIRNEWGCRCNGSSDPLVIAASIIGILHLILWILDRLLFKCIYRRFKYGLKRGPSTEGVPESMREEYRKEQQSAVDADDGHFVNIEPE

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • M
  • Full Name
  • Matrix protein 2
  • Alternative Names
  • M; Record to support submission of GeneRIFs for a gene not in Gene; Proton channel protein M2; Matrix protein 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us