Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Pig TSPO (Translocator protein) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0922K)

This product is a Pig TSPO membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Pig
  • Target Protein
  • TSPO
  • Protein Length
  • Full Length
  • Protein Class
  • Transport
  • Molecular Weight
  • 38.6 kDa
  • TMD
  • 5
  • Sequence
  • MAPPWLPAVGFTLVPSLGGFLSSRNVLGKGLHWYAGLQKPSWHPPHWTLAPIWGTLYSAMGYGSYMIWKELGGFSEEAVVPLGLYAGQLALNWAWPPLFFGARQMGWALVDLVLTGGVAAATAVAWYQVSPLAARLLYPYLAWLAFAATLNYCVWRDNQGRRGGRRPSE

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis and SUMO tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • TSPO
  • Full Name
  • Translocator protein
  • Alternative Names
  • TSPO; PBR; BZRP; peripheral benzodiazepine receptor; peripheral-type benzodiazepine receptor; Translocator protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us